PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim08g062510.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 654aa    MW: 73928.4 Da    PI: 6.1252
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim08g062510.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.41e-172677556
                        SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        ++++ eq+++L ++F+k+++p++++ ++L ++ gL+ +qVk+WFqNrRa+ k
  Sopim08g062510.0.1 26 HKHSMEQIQILDAFFKKCPHPDEDQQKQLGSEAGLDHKQVKFWFQNRRAQAK 77
                        57899********************************************998 PP

2START1097.3e-351753935206
                         HHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
               START   5 eaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                         + ++e v + + ++p+Wv ss            +++ ++f +++v       +++e ++++g+v m++++l   +ld   +W + ++    
  Sopim08g062510.0.1 175 ASMNEMVELWKMNDPFWVDSSsdrrcfiH---HEIYGRNF-SNQVlppqtstCRIESSKDCGIVSMTAVELIHNFLDPV-KWMNLFPtivt 260
                         679999999************77754331...44444455.33445777789**************************9.99999999999 PP

                         EEEEEEEECTT...EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEE CS
               START  78 kaetlevissg...galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghsk 163
                         ka+t+ev++sg   g  qlm+ +l  lsplv  R+f+f+R +rql a +w+ vd+S d  ++ ++  +s+    ++pSg+ i++++ng sk
  Sopim08g062510.0.1 261 KAKTIEVVDSGtwgGSMQLMYEKLHILSPLVEaREFLFIRGCRQLDATTWIMVDISYDIFNDIQSgVPSYSW--KFPSGCAIQDMGNGQSK 349
                         *******************************99***********************9998888766667765..9**************** PP

                         EEEEE-EE-.-SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 164 vtwvehvdl.kgrlphwllrslvksglaegaktwvatlqrqcek 206
                         vtwvehv + +++++  ++r l+  + a gak+w  tlqr ce+
  Sopim08g062510.0.1 350 VTWVEHVQVyEKYHVNHIFRDLLCDREAYGAKRWIVTLQRMCER 393
                         *******96267789***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-17577IPR009057Homeodomain-like
SMARTSM003892.3E-121683IPR001356Homeobox domain
PROSITE profilePS5007114.5921979IPR001356Homeobox domain
SuperFamilySSF466892.4E-152482IPR009057Homeodomain-like
PfamPF000463.7E-152677IPR001356Homeobox domain
CDDcd000861.07E-132977No hitNo description
PROSITE profilePS5084832.273162396IPR002913START domain
CDDcd088751.23E-75166392No hitNo description
SuperFamilySSF559612.33E-21169394No hitNo description
SMARTSM002344.2E-19171393IPR002913START domain
PfamPF018521.4E-28175393IPR002913START domain
Gene3DG3DSA:3.30.530.205.9E-4231356IPR023393START-like domain
SuperFamilySSF559611.15E-10415616No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 654 aa     Download sequence    Send to blast
MTDSGEEPAG ESSNSQKRSE SHGQYHKHSM EQIQILDAFF KKCPHPDEDQ QKQLGSEAGL  60
DHKQVKFWFQ NRRAQAKDEK VSSLISHVFG RPFVMDSNLA PQISTLGSPS NSSDGSLLNE  120
DTRGSPIIYP PLRQENNQNS NNFHAHSMIS QSPQEHDECN HDSRQQTIMF ETVVASMNEM  180
VELWKMNDPF WVDSSSDRRC FIHHEIYGRN FSNQVLPPQT STCRIESSKD CGIVSMTAVE  240
LIHNFLDPVK WMNLFPTIVT KAKTIEVVDS GTWGGSMQLM YEKLHILSPL VEAREFLFIR  300
GCRQLDATTW IMVDISYDIF NDIQSGVPSY SWKFPSGCAI QDMGNGQSKV TWVEHVQVYE  360
KYHVNHIFRD LLCDREAYGA KRWIVTLQRM CERFNFQMGS TYPNRHDSKG VFHDPEGLKN  420
TIQVSQRMVK KFFEILSMTD NHGDFSISPQ LNRGDRISIV KNEETIQPKG FIAIATTSLW  480
LPLSFQDVFS FFNDYKTRNQ WDILTGGNNV IELDRVLTGT FPGNNITVIQ PYNMHKEMLV  540
LEETSIDEMG AFLVYAPIDL RAINSIVNGG DATKVPFLPS GIIISPDGRL SSNRDSTPNA  600
QNGSILTVTF QIMICGNNNP TSRQQKMEVV GSVHGVLSAT ILRIKEALGC SDL*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0109300.0AP010930.1 Solanum lycopersicum DNA, chromosome 8, clone: C08SLe0034G06, complete sequence.
GenBankHG9755200.0HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010326439.10.0PREDICTED: homeobox-leucine zipper protein HDG8-like isoform X2
TrEMBLK4CL390.0K4CL39_SOLLC; Uncharacterized protein
STRINGSolyc08g062510.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10211732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03260.11e-127homeodomain GLABROUS 8